Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

5,341 – 5,355 of 1,824,710 results

5,341

Invitrogen™ Thrombospondin 2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P35442
Isotype	IgG
Concentration	500 μg/mL
Antigen	Thrombospondin 2
Gene Symbols	THBS2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Thbs2; Thbs-2; thrombospondin 2; Thrombospondin2; thrombospondin-2; TSP2; TSP-2; TSP2thrombospondin-2
Gene	THBS2
Product Type	Antibody
Gene ID (Entrez)	7058
Formulation	Antibody with 0.2mg Na2PO4, 0.9mg NaCl, 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence in the middle region of human Thrombospondin 2 (637-655aa EAAKTEKQVCEPENPCKDK).
Classification	Polyclonal
Primary or Secondary	Primary

5,342

Invitrogen™ IGF1R (CD221) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P08069, P24062, Q60751
Isotype	IgG
Concentration	500 μg/mL
Antigen	IGF1R (CD221)
Gene Symbols	IGF1R
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	A330103N21Rik; CD221; CD221 antigen; D930020L01; hyft; IGF 1 receptor; IGF 1R; IGF1R; IGF-1R; IGF-I receptor; IGFIR; IGFIRC; IGFR; Igfr1; insulin like growth factor 1 receptor; Insulin like growth factor 1 receptor precursor; insulin-like growth factor 1 receptor; Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain; Insulin-like growth factor I receptor; JTK13; line 186; soluble IGF1R variant 1; soluble IGF1R variant 2
Gene	IGF1R
Product Type	Antibody
Gene ID (Entrez)	16001, 25718, 3480
Formulation	Antibody with 4mg trehalose, 0.9mg NaCl, 0.2mg Na2PO4 and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human IGF1 Receptor (1353-1367aa RKNERALPLPQSSTC).
Classification	Polyclonal
Primary or Secondary	Primary

5,343

Invitrogen™ CD41 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P08514, Q9QUM0
Isotype	IgG
Concentration	500 μg/mL
Antigen	CD41
Gene Symbols	Itga2b
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI172977; alpha IIb; alphaIIb; alphaIIb protein; BDPLT16; BDPLT2; CD41; CD41B; form 1; form 2; GP IIb; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; integrin alpha 2b; integrin alpha 2b (Cd41b); integrin alpha-IIb; Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain; Integrin alpha-IIb light chain, form 1; Integrin alpha-IIb light chain, form 2; integrin subunit alpha 2b; integrin subunit alpha IIb; integrin, alpha 2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITGA2B; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb; platelet glycoprotein IIb of IIb/II Ia complex; platelet glycoprotein IIb of IIb/IIIa complex; platelet membrane glycoprotein IIb; platelet-specific antigen BAK; PPP1R93; protein phosphatase 1, regulatory subunit 93
Gene	Itga2b
Product Type	Antibody
Gene ID (Entrez)	16399, 3674, 685269
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN).
Classification	Polyclonal
Primary or Secondary	Primary

5,344

Invitrogen™ VWF Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	Q62935, Q8CIZ8
Isotype	IgG
Concentration	500 μg/mL
Antigen	VWF
Gene Symbols	VWF
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	6820430P06Rik; AI551257; B130011O06Rik; C630030D09; Coagulation Factor VIII; coagulation factor VIII VWF; EMBL:CAB37852.1}; F8VWF; factor viii related antigen; von Willebrand antigen 2; von Willebrand antigen II; von Willebrand Disease (vWD); von Willebrand factor; Von Willebrand factor homolog; VWD; vwf; vwf {ECO:0000312
Gene	VWF
Product Type	Antibody
Gene ID (Entrez)	116669, 22371
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	E.coli-derived mouse VWF recombinant protein (Position: M1304-E1452).
Classification	Polyclonal
Primary or Secondary	Primary

5,345

Invitrogen™ CD11b Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P05555, P11215
Isotype	IgG
Concentration	500 μg/mL
Antigen	CD11b
Gene Symbols	ITGAM
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	antigen CD11b (p170); antigen CD11b (p170); macrophage antigen alpha polypeptide; CD11 antigen-like family member B; CD11b; CD11B (p170); CD11b/CD18; cell surface glycoprotein MAC-1 alpha subunit; cell surface glycoprotein MAC-1 subunit alpha; complement component 3 receptor 3 subunit; complement component receptor 3 alpha-a; complement receptor type 3; CR3; CR-3 alpha chain; CR3A; F730045J24Rik; integrin alpha M; integrin alpha-M; integrin subunit alpha M; integrin, alpha M; integrin, alpha M (complement component 3 receptor 3 subunit); ITGAM; Leukocyte adhesion receptor MO1; leukocyte integrin alpha-M chain; LOC100351865; Ly-40; MAC1; Mac-1; Mac-1 alpha; Mac-1 alpha (Mac1A); MAC-1 alpha subunit; MAC1A; Mac-1a; macrophage antigen alpha; macrophage antigen alpha polypeptide; MGC117044; MO1A; Neutrophil adherence receptor; neutrophil adherence receptor alpha-M subunit; SLEB6; unnamed protein product
Gene	ITGAM
Product Type	Antibody
Gene ID (Entrez)	16409, 25021, 3684
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	E.coli-derived human CD11b recombinant protein (Position: F17-T382).
Classification	Polyclonal
Primary or Secondary	Primary

5,346

Invitrogen™ CD23 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunocytochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P06734, P20693
Isotype	IgG
Concentration	500 μg/mL
Antigen	CD23
Gene Symbols	FCER2, Fcer2a
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	BLAST-2; CD23; CD23 antigen; CD23A; CLEC4J; C-type lectin domain family 4 member J; C-type lectin domain family 4, member J; Fc epsilon receptor II; FC epsilon RII; Fc fragment of IgE receptor II; Fc fragment of IgE, low affinity II, receptor for (CD23); Fc receptor alpha multiple ligand receptor; Fc receptor, IgE, low affinity II, alpha polypeptide; Fcalpha muR; Fcalpha RII; Fce2; fc-epsilon-RII; FCER2; Fcer2a; FceRII; IGEBF; Immunoglobulin E-binding factor; immunoglobulin epsilon-chain; low affinity immunoglobulin epsilon Fc receptor; Low affinity immunoglobulin epsilon Fc receptor membrane-bound form; Low affinity immunoglobulin epsilon Fc receptor soluble form; low-affinity IgE receptor; Ly-42; lymphocyte IgE receptor
Gene	FCER2
Product Type	Antibody
Gene ID (Entrez)	14128, 171075, 2208
Formulation	PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen	E.coli-derived mouse CD23 recombinant protein (Position: E50-P331).
Classification	Polyclonal
Primary or Secondary	Primary

5,347

Invitrogen™ KIM-1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	Q96D42
Isotype	IgG
Concentration	500 μg/mL
Antigen	KIM-1
Gene Symbols	Havcr1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AI503787; CD365; HAVCR; HAVCR1; HAVcr-1; Hepatitis A virus cellular receptor 1; hepatitis A virus cellular receptor 1 homolog; Kidney injury molecule 1; Kim1; KIM-1; T cell immunoglobin domain and mucin domain protein 1; t cell immunoglobulin and mucin domain-containing protein 1; T cell membrane protein 1; T-cell immunoglobulin and mucin domain containing 1; T-cell immunoglobulin and mucin domain-containing protein 1; T-cell immunoglobulin mucin family member 1; T-cell immunoglobulin mucin receptor 1; T-cell membrane protein 1; TIM; TIM1; TIM-1; TIMD1; TIMD-1
Gene	Havcr1
Product Type	Antibody
Gene ID (Entrez)	26762
Formulation	PBS with 5mg BSA and 0.05mg thimerosal, 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human TIM 1 (332-348aa IKALQNAVEKEVQAEDN).
Classification	Polyclonal
Primary or Secondary	Primary

5,348

Invitrogen™ HYAL1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Monkey,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunocytochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	Q12794, Q76HN1, Q91ZJ9
Isotype	IgG
Concentration	500 μg/mL
Antigen	HYAL1
Gene Symbols	HYAL1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Hya1; HYAL1; Hyal-1; Hyaluronidase; hyaluronidase 1; hyaluronidase-1; hyaluronoglucosaminidase 1; hyaluronoglucosaminidase-1; LUCA1; LuCa-1; Lung carcinoma protein 1; MPS9; NAT6; plasma hyaluronidase; tumor suppressor LUCA-1
Gene	HYAL1
Product Type	Antibody
Gene ID (Entrez)	15586, 3373, 367166
Formulation	PBS with 5mg BSA and 0.05mg thimerosal, 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human HYAL1 (32-47aa FTTVWNANTQWCLERH).
Classification	Polyclonal
Primary or Secondary	Primary

5,349

Invitrogen™ Osteopontin Monoclonal Antibody (2F10), eFluor™ 660, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	eFluor 660
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P10451
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	Osteopontin
Gene Symbols	SPP1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	2AR; 2b7; 44 kDa bone phosphoprotein; Apl-1; BNSP; Bone sialoprotein 1; Bone sialoprotein 1 (BSPI/BSP1); Bsp; BSPI; Calcium oxalate crystal growth inhibitor protein; CALPHA1 fusion; Early T lymphocyte activation 1 (ETA1); early T-lymphocyte activation 1; early T-lymphocyte activation 1 protein; Eta; ETA-1; HGNC:11255; immunoglobulin alpha 1 heavy chain constant region fusion protein; MGC110940; Minopontin; nephropontin; Op; Opn; Opnl; OSP; osteopontin; osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein; osteopontin-like protein; PSEC0156; Ric; Secreted phosphoprotein 1; secreted phosphoprotein 1 (osteopontin bone sialoprotein I early T lymphocyte activation 1); secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1); Secreted phosphoprotein 1 (SPP1); secreted phosphoprotein 1 variant 6; Sialoprotein (osteopontin); SPP1; SPP-1; SPP1/CALPHA1 fusion; unnamed protein product; urinar; urinary stone protein; Uropontin
Gene	SPP1
Product Type	Antibody
Gene ID (Entrez)	6696
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2F10

5,350

Phospho-4EBP1 (Thr36, Thr45) Monoclonal Antibody (V3NTY24), eFluor™ 660, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	eFluor 660
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2b κ
Gene Accession No.	Q13541, Q60876
Concentration	5 μL/Test
Antigen	Phospho-4EBP1 (Thr36, Thr45)
Gene Symbols	EIF4EBP1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	4EBP1; 4E-BP1; AA959816; BP-1; eIF4E-binding protein 1; EIF4EBP1; eukaryotic translation initiation factor 4E binding protein 1; eukaryotic translation initiation factor 4E-binding protein 1; MGC431; MGC4316; P/OKCL.6; PHAS-1; PHAS-I; Phosphorylated heat- and acid-stable protein regulated by insulin 1
Gene	EIF4EBP1
Product Type	Antibody
Gene ID (Entrez)	13685, 1978
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	V3NTY24

5,351

Invitrogen™ MAX Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunocytochemistry,Western Blot
Form	Lyophilized
Gene Accession No.	P28574, P61244
Isotype	IgG
Concentration	500 μg/mL
Antigen	MAX
Gene Symbols	MAX
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AA960152; AI875693; bHLHd4; bHLHd5; bHLHd6; bHLHd7; bHLHd8; Class D basic helix-loop-helix protein 4; Delta-Max; Max; Max protein; MGC10775; MGC11225; MGC18164; MGC34679; MGC36767; MYC associated factor X; myc-associated factor X; Myc-binding novel HLH/LZ protein; Myn; orf1; Protein max; protein myn
Gene	MAX
Product Type	Antibody
Gene ID (Entrez)	17187, 4149
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	E. coli-derived human MAX recombinant protein (Position: A30-R106).
Classification	Polyclonal
Primary or Secondary	Primary

5,352

Invitrogen™ PSD-95 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P31016, Q62108
Isotype	IgG
Concentration	0.15 mg/mL
Antigen	PSD-95
Gene Symbols	DLG4
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	discs large homolog 4; discs large MAGUK scaffold protein 4; discs, large homolog 4; discs, large homolog 4 (Drosophila); disks large homolog 4; Dlg4; Dlgh4; FLJ97752; FLJ98574; post synaptic density; postsynaptic density protein 95; post-synaptic density protein 95; PSD95; PSD-95; PSD-95 alpha 2b; PSD-95 beta; Sap90; SAP-90; SAP90A; Synapse-associated protein 90; synapse-associated protein SAP90; Tax interaction protein 15
Gene	DLG4
Product Type	Antibody
Gene ID (Entrez)	13385, 29495
Formulation	PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the N-terminus region of mouse PSD95. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

5,353

CD279 (PD-1) Monoclonal Antibody (MIH4), PE-Cyanine7, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	PE-Cyanine7
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	Q15116
Concentration	5 μL/Test
Antigen	CD279 (PD-1)
Regulatory Status	RUO
Purification Method	Affinity chromatography
Product Type	Antibody
Gene ID (Entrez)	5133
Classification	Monoclonal
Primary or Secondary	Primary
Clone	MIH4

5,354

CD184 (CXCR4) Monoclonal Antibody (2B11), PE-Cyanine7, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	PE-Cyanine7
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2b κ
Gene Accession No.	P70658
Concentration	0.2 mg/mL
Antigen	CD184 (CXCR4)
Gene Symbols	Cxcr4
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	b2b220Clo; C Cmotif chemokine; C X C motif chemokine; CC motif chemokine; CCmotif chemokine; CD antigen CD184; CD184; CD184 antigen; chemokine (C-X-C motif) receptor 4; chemokine (C-X-C) receptor 4; chemokine receptor; chemokine receptor (LCR1); chemokine receptor 4; chemokine receptor CXCR4; Cmkar4; CXC; CXC chemokine receptor; C-X-C chemokine receptor type 4; CXC motif chemokine; C-X-C motif chemokine receptor 4; CXCR4; CXC-R4; CXCR-4; D2S201E; FB22; Fusin; HM89; HSY3RR; HUMSTR; LAP3; LAP-3; LCR1; LESTR; Leukocyte-derived seven transmembrane domain receptor; leukocyte-expressed seven-transmembrane-domain; lipopolysaccharide-associated protein 3; LPS-associated protein 3; neuropeptide Y receptor Y3; neuropeptide Y3 receptor; NPY3R; NPYR; NPYRL; NPYY3R; PB-CKR; PBSF/SDF-1; pre-B-cell-derived chemokine receptor; SDF-1 receptor; Sdf1r; seven transmembrane helix receptor; seven-transmembrane-segment receptor, spleen; stromal cell-derived factor 1 receptor; WHIM; WHIMS
Gene	Cxcr4
Product Type	Antibody
Gene ID (Entrez)	12767
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2B11

5,355

Invitrogen™ CD30 Monoclonal Antibody (Ber-H2), PE, eBioscience™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	P28908
Isotype	IgG1 κ
Concentration	5 μL/Test
Antigen	CD30
Gene Symbols	TNFRSF8
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Ber-H2; Cd30; CD30 antigen; CD30 molecule; CD30L receptor; cytokine receptor CD30; D1S166E; Ki; Ki-1; Ki-1 antigen; Lymphocyte activation antigen CD30; sCD30; soluble CD30; TNF receptor superfamily member 8; TNFRSF8; Tumor necrosis factor receptor superfamily member 8; tumor necrosis factor receptor superfamily, member 8; Tumor necrosis factor superfamily member 8; tumor necrosis factor superfamily, member CD30
Gene	TNFRSF8
Product Type	Antibody
Gene ID (Entrez)	943
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	Ber-H2

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ Thrombospondin 2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ IGF1R (CD221) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD41 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ VWF Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD11b Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD23 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ KIM-1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ HYAL1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Osteopontin Monoclonal Antibody (2F10), eFluor™ 660, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Phospho-4EBP1 (Thr36, Thr45) Monoclonal Antibody (V3NTY24), eFluor™ 660, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MAX Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PSD-95 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD279 (PD-1) Monoclonal Antibody (MIH4), PE-Cyanine7, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD184 (CXCR4) Monoclonal Antibody (2B11), PE-Cyanine7, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD30 Monoclonal Antibody (Ber-H2), PE, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Thrombospondin 2 Polyclonal Antibody

Invitrogen™ IGF1R (CD221) Polyclonal Antibody

Invitrogen™ CD41 Polyclonal Antibody

Invitrogen™ VWF Polyclonal Antibody

Invitrogen™ CD11b Polyclonal Antibody

Invitrogen™ CD23 Polyclonal Antibody

Invitrogen™ KIM-1 Polyclonal Antibody

Invitrogen™ HYAL1 Polyclonal Antibody

Invitrogen™ Osteopontin Monoclonal Antibody (2F10), eFluor™ 660, eBioscience™

Phospho-4EBP1 (Thr36, Thr45) Monoclonal Antibody (V3NTY24), eFluor™ 660, eBioscience™, Invitrogen™

Invitrogen™ MAX Polyclonal Antibody

Invitrogen™ PSD-95 Polyclonal Antibody

CD279 (PD-1) Monoclonal Antibody (MIH4), PE-Cyanine7, eBioscience™, Invitrogen™

CD184 (CXCR4) Monoclonal Antibody (2B11), PE-Cyanine7, eBioscience™, Invitrogen™

Invitrogen™ CD30 Monoclonal Antibody (Ber-H2), PE, eBioscience™